PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_11833A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 227aa    MW: 24167 Da    PI: 9.5707
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_11833AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.4e-171764148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT eEd++lv ++ ++G g+W+  ar  g++R +k+c++rw++yl
  Oropetium_20150105_11833A 17 KGPWTLEEDLILVSYISEHGEGSWDNLARAAGLNRNGKSCRLRWLNYL 64
                               79********************************************97 PP

2Myb_DNA-binding47.73.7e-1570113146
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                rg+ T+ Ed  + ++ ++lG++ W++Ia++++ gRt++++k++w++
  Oropetium_20150105_11833A  70 RGSITPAEDAAIRELQALLGNK-WSKIAKHLP-GRTDNEIKNYWRT 113
                                7889******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.1861264IPR017930Myb domain
SuperFamilySSF466892.4E-3015111IPR009057Homeodomain-like
SMARTSM007172.9E-141666IPR001005SANT/Myb domain
PfamPF002492.0E-151764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-201870IPR009057Homeodomain-like
CDDcd001671.19E-111964No hitNo description
PROSITE profilePS5129424.83865119IPR017930Myb domain
SMARTSM007174.4E-1469117IPR001005SANT/Myb domain
PfamPF002491.2E-1370113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-2471118IPR009057Homeodomain-like
CDDcd001673.55E-1274113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MASRTVQVCG GEPAVRKGPW TLEEDLILVS YISEHGEGSW DNLARAAGLN RNGKSCRLRW  60
LNYLRPGVRR GSITPAEDAA IRELQALLGN KWSKIAKHLP GRTDNEIKNY WRTRIQKRAP  120
PPSATAQHQK LLRRQQATAA AISEGASSSS GTSASQDSSG AAASGDCCFM TQPKTEQRRL  180
AAYSCQLLQE EAPVLSAAAP APTVKSEGGA SSAFASQASS TTTAGDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26111191108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7281931e-114KJ728193.1 Zea mays clone pUT6467 MYB transcription factor (MYB53) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969272.18e-74PREDICTED: myb-related protein 340-like
TrEMBLK3XPY59e-74K3XPY5_SETIT; Uncharacterized protein
STRINGSi003965m3e-73(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132402633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.15e-57myb domain protein 21